"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8ZNS1"	"{'domain_architectures': 79589, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 3, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 79589}"	"['Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane']"	"atpB2"	"[{'identifier': 'GO:0015078', 'name': 'proton transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015986', 'name': 'proton motive force-driven ATP synthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0045259', 'name': 'proton-transporting ATP synthase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"ATP62_ACAM1"	"acaa664a20e87c3445188e8a4619f81f602dd2b5"	True	False	False	234	"ATP synthase subunit a 2"	3	"UP000000268"	"MHLTPDQTIFWQWGLFSLNATLIFTWLVMGVLVVGSWFVTRHLSASTQISRGQNLLEVIVLGIRDQIQEIIDQPADPYLPFIGTLFIFIALSNLLSVIPGYQPPTGSLSTTTALALCVFFAVPLYGVQKKGVRGYLQQYLQPNPIMLPFNIIGDFSRIVALAVRLFGNVMSGTMIVGILLSVAPLFFPVMMQVLGLLTGVIQAYIFAILAMVFIAAASQVDQHNYQTDSEVSHG"	"reviewed"	"{'taxId': '329726', 'scientificName': 'Acaryochloris marina (strain MBIC 11017)', 'fullName': 'Acaryochloris marina (strain MBIC 11017)'}"
