General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8SD59",
        "id": "A8SD59_9FIRM",
        "source_organism": {
            "taxId": "411485",
            "scientificName": "Faecalibacterium prausnitzii M21/2",
            "fullName": "Faecalibacterium prausnitzii M21/2"
        },
        "name": "Large ribosomal subunit protein uL10",
        "description": [
            "Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors"
        ],
        "length": 171,
        "sequence": "MPSAKILSEKQAYVADLKAKFESAVSGCVVAYGGINVENDTKLRKELREAGVDYMVVKNTMLRLAVKGTALEGLAENFKGDTAVAFAHEDDPMAAARILCKYQDGDKSKKFVVKAGFMEGKAMNAAETNAIAKLPNREGMLSMFAGALTSTLSGLAVAMQAYADKQEEPAA",
        "proteome": null,
        "gene": "rplJ",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "566544af311940aa66ef32ae4418b9a3694a6e12",
        "counters": {
            "domain_architectures": 13988,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "hamap": 1,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 13988
        }
    }
}