"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8SD59"	"{'domain_architectures': 13988, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'hamap': 1, 'pfam': 2, 'panther': 1, 'ncbifam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 13988}"	"['Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors']"	"rplJ"	""	"A8SD59_9FIRM"	"566544af311940aa66ef32ae4418b9a3694a6e12"	True	False	False	171	"Large ribosomal subunit protein uL10"	3	""	"MPSAKILSEKQAYVADLKAKFESAVSGCVVAYGGINVENDTKLRKELREAGVDYMVVKNTMLRLAVKGTALEGLAENFKGDTAVAFAHEDDPMAAARILCKYQDGDKSKKFVVKAGFMEGKAMNAAETNAIAKLPNREGMLSMFAGALTSTLSGLAVAMQAYADKQEEPAA"	"unreviewed"	"{'taxId': '411485', 'scientificName': 'Faecalibacterium prausnitzii M21/2', 'fullName': 'Faecalibacterium prausnitzii M21/2'}"