General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8R6N5",
        "id": "A8R6N5_SALET",
        "source_organism": {
            "taxId": "119912",
            "scientificName": "Salmonella enterica subsp. enterica serovar Choleraesuis",
            "fullName": "Salmonella enterica subsp. enterica serovar Choleraesuis"
        },
        "name": "Mercuric transport protein MerT",
        "description": [
            "Involved in mercury resistance. Probably transfers a mercuric ion from the periplasmic Hg(2+)-binding protein MerP to the cytoplasmic mercuric reductase MerA"
        ],
        "length": 116,
        "sequence": "MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPLFIGAALVALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLVLVALGFPYVVPFFY",
        "proteome": null,
        "gene": "merT",
        "go_terms": [
            {
                "identifier": "GO:0015097",
                "name": "mercury ion transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015694",
                "name": "mercury ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9f290a4adbd8aa68c85f886cf924839ec8644a9d",
        "counters": {
            "domain_architectures": 2515,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2515
        }
    }
}