"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8R6N5"	"{'domain_architectures': 2515, 'entries': 4, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2515}"	"['Involved in mercury resistance. Probably transfers a mercuric ion from the periplasmic Hg(2+)-binding protein MerP to the cytoplasmic mercuric reductase MerA']"	"merT"	"[{'identifier': 'GO:0015097', 'name': 'mercury ion transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015694', 'name': 'mercury ion transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A8R6N5_SALET"	"9f290a4adbd8aa68c85f886cf924839ec8644a9d"	True	False	False	116	"Mercuric transport protein MerT"	3	""	"MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPLFIGAALVALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLVLVALGFPYVVPFFY"	"unreviewed"	"{'taxId': '119912', 'scientificName': 'Salmonella enterica subsp. enterica serovar Choleraesuis', 'fullName': 'Salmonella enterica subsp. enterica serovar Choleraesuis'}"