General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8H537",
        "id": "RNFB_SHEPA",
        "source_organism": {
            "taxId": "398579",
            "scientificName": "Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)",
            "fullName": "Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)"
        },
        "name": "Ion-translocating oxidoreductase complex subunit B",
        "description": [
            "Part of a membrane-bound complex that couples electron transfer with translocation of ions across the membrane"
        ],
        "length": 189,
        "sequence": "MSAIVIAIVVLTILALVFGVLLGFAAEKFKVEGNPLTDQIEALLPQTQCGQCGYPGCRPYAEAIANGDKVNKCPPGGAATMEKLADLMGVEPEPLNVTEAVQIKKVAYIREDECIGCTKCIQACPVDAILGSGKLMHTVITDYCTGCDLCVAPCPVDCIDMLPVEQTTKTWNWQLNAIPVKQLQEDKPC",
        "proteome": "UP000002608",
        "gene": "rnfB",
        "go_terms": [
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0022900",
                "name": "electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7d11a6ff757581088976d88daf247c9fddc34cd2",
        "counters": {
            "domain_architectures": 6628,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 2,
                "ncbifam": 2,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6628
        }
    }
}