"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8H537"	"{'domain_architectures': 6628, 'entries': 19, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 2, 'cathgene3d': 2, 'ssf': 1, 'pfam': 2, 'ncbifam': 2, 'hamap': 1, 'pirsf': 1, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6628}"	"['Part of a membrane-bound complex that couples electron transfer with translocation of ions across the membrane']"	"rnfB"	"[{'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0022900', 'name': 'electron transport chain', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005886', 'name': 'plasma membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RNFB_SHEPA"	"7d11a6ff757581088976d88daf247c9fddc34cd2"	True	False	False	189	"Ion-translocating oxidoreductase complex subunit B"	3	"UP000002608"	"MSAIVIAIVVLTILALVFGVLLGFAAEKFKVEGNPLTDQIEALLPQTQCGQCGYPGCRPYAEAIANGDKVNKCPPGGAATMEKLADLMGVEPEPLNVTEAVQIKKVAYIREDECIGCTKCIQACPVDAILGSGKLMHTVITDYCTGCDLCVAPCPVDCIDMLPVEQTTKTWNWQLNAIPVKQLQEDKPC"	"reviewed"	"{'taxId': '398579', 'scientificName': 'Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)', 'fullName': 'Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)'}"