HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A8GP56",
"id": "CCME_RICAH",
"source_organism": {
"taxId": "293614",
"scientificName": "Rickettsia akari (strain Hartford)",
"fullName": "Rickettsia akari (strain Hartford)"
},
"name": "Cytochrome c-type biogenesis protein CcmE",
"description": [
"Heme chaperone required for the biogenesis of c-type cytochromes. Transiently binds heme delivered by CcmC and transfers the heme to apo-cytochromes in a process facilitated by CcmF and CcmH"
],
"length": 128,
"sequence": "MQKRVRNRLITIIICFCSAALGISIILYNLEKNIVFFLPPSKINEIEEGKELRVGGLVKIDSINKIAADKISFVITDNIKDLDILYQGVLPALFREGQGIIAIGQLLDRKFIARQLLAKHDENYRPPS",
"proteome": "UP000006830",
"gene": "ccmE",
"go_terms": [
{
"identifier": "GO:0017003",
"name": "protein-heme linkage",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0017004",
"name": "cytochrome complex assembly",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005886",
"name": "plasma membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0020037",
"name": "heme binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4def072560e09e570e27d0496aff3fe3d453f884",
"counters": {
"domain_architectures": 10929,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10929
}
}
}