"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8GP56"	"{'domain_architectures': 10929, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 10929}"	"['Heme chaperone required for the biogenesis of c-type cytochromes. Transiently binds heme delivered by CcmC and transfers the heme to apo-cytochromes in a process facilitated by CcmF and CcmH']"	"ccmE"	"[{'identifier': 'GO:0017003', 'name': 'protein-heme linkage', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0017004', 'name': 'cytochrome complex assembly', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005886', 'name': 'plasma membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0020037', 'name': 'heme binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"CCME_RICAH"	"4def072560e09e570e27d0496aff3fe3d453f884"	True	False	False	128	"Cytochrome c-type biogenesis protein CcmE"	3	"UP000006830"	"MQKRVRNRLITIIICFCSAALGISIILYNLEKNIVFFLPPSKINEIEEGKELRVGGLVKIDSINKIAADKISFVITDNIKDLDILYQGVLPALFREGQGIIAIGQLLDRKFIARQLLAKHDENYRPPS"	"reviewed"	"{'taxId': '293614', 'scientificName': 'Rickettsia akari (strain Hartford)', 'fullName': 'Rickettsia akari (strain Hartford)'}"