General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8FL56",
        "id": "YQGF_CAMJ8",
        "source_organism": {
            "taxId": "407148",
            "scientificName": "Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)",
            "fullName": "Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)"
        },
        "name": "Putative pre-16S rRNA nuclease",
        "description": [
            "Could be a nuclease involved in processing of the 5'-end of pre-16S rRNA"
        ],
        "length": 127,
        "sequence": "MRALALDVGLKRIGVALCIDKKIALPLDAVLRKNRNQAANEIKNLLKIHEISLLIVGIPKGGSSEEEMTRRIKHFVSLLEFDKEICFVDESGTSKEALGYGVANTRKKDGKLDSLSAFIMIKDYFAL",
        "proteome": null,
        "gene": "C8J_0594",
        "go_terms": [
            {
                "identifier": "GO:0006139",
                "name": "nucleobase-containing compound metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006364",
                "name": "rRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ae173ed84f2e53482ced8e6b50a39f6314c11faa",
        "counters": {
            "domain_architectures": 26346,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26346
        }
    }
}