"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8FL56"	"{'domain_architectures': 26346, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 2, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 26346}"	"[""Could be a nuclease involved in processing of the 5'-end of pre-16S rRNA""]"	"C8J_0594"	"[{'identifier': 'GO:0006139', 'name': 'nucleobase-containing compound metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006364', 'name': 'rRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"YQGF_CAMJ8"	"ae173ed84f2e53482ced8e6b50a39f6314c11faa"	True	False	False	127	"Putative pre-16S rRNA nuclease"	3	""	"MRALALDVGLKRIGVALCIDKKIALPLDAVLRKNRNQAANEIKNLLKIHEISLLIVGIPKGGSSEEEMTRRIKHFVSLLEFDKEICFVDESGTSKEALGYGVANTRKKDGKLDSLSAFIMIKDYFAL"	"reviewed"	"{'taxId': '407148', 'scientificName': 'Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)', 'fullName': 'Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)'}"
