General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A7XEY9",
        "id": "A7XEY9_9CAUD",
        "source_organism": {
            "taxId": "448384",
            "scientificName": "Escherichia phage Phi1",
            "fullName": "Escherichia phage Phi1"
        },
        "name": "RNA polymerase sigma-like factor",
        "description": [
            "Plays a role in the transcription of the viral late genes by acting as a late promoter recognition subunit. Associates with host RNA polymerase (RNAP) core and thus replaces the host sigma-70/rpoD subunit in the complex. May also play a role in DNA packaging by interacting with the terminase subunit gp17"
        ],
        "length": 177,
        "sequence": "MSDYVNNKELYEEICRWKQRIAAEGRQVPMSDQIGLAIMQISKNLSRRFNFSGYSQTWREEMIDDGIEAAVKGLINFDETKYKNPHAYITQACFNAFVQRIKKERTATAAKYKYFVHHVYDERDADMCQIADEAFIQDIYDKINNYEESVNKPKAPKVEDVLTEELPSLDQFYEIEN",
        "proteome": "UP000001124",
        "gene": "55",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:2000142",
                "name": "regulation of DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}