"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7XEY9"	"{'domain_architectures': 0, 'entries': 2, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'hamap': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1}"	"['Plays a role in the transcription of the viral late genes by acting as a late promoter recognition subunit. Associates with host RNA polymerase (RNAP) core and thus replaces the host sigma-70/rpoD subunit in the complex. May also play a role in DNA packaging by interacting with the terminase subunit gp17']"	"55"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:2000142', 'name': 'regulation of DNA-templated transcription initiation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A7XEY9_9CAUD"	""	False	False	False	177	"RNA polymerase sigma-like factor"	3	"UP000001124"	"MSDYVNNKELYEEICRWKQRIAAEGRQVPMSDQIGLAIMQISKNLSRRFNFSGYSQTWREEMIDDGIEAAVKGLINFDETKYKNPHAYITQACFNAFVQRIKKERTATAAKYKYFVHHVYDERDADMCQIADEAFIQDIYDKINNYEESVNKPKAPKVEDVLTEELPSLDQFYEIEN"	"unreviewed"	"{'taxId': '448384', 'scientificName': 'Escherichia phage Phi1', 'fullName': 'Escherichia phage Phi1'}"