GET /api/protein/UniProt/A7MF58/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A7MF58",
        "id": "SUFE_CROS8",
        "source_organism": {
            "taxId": "290339",
            "scientificName": "Cronobacter sakazakii (strain ATCC BAA-894)",
            "fullName": "Cronobacter sakazakii (strain ATCC BAA-894)"
        },
        "name": "Cysteine desulfuration protein SufE",
        "description": [
            "Participates in cysteine desulfuration mediated by SufS. Cysteine desulfuration mobilizes sulfur from L-cysteine to yield L-alanine and constitutes an essential step in sulfur metabolism for biosynthesis of a variety of sulfur-containing biomolecules. Functions as a sulfur acceptor for SufS, by mediating the direct transfer of the sulfur atom from the S-sulfanylcysteine of SufS, an intermediate product of cysteine desulfuration process"
        ],
        "length": 138,
        "sequence": "MAGLPEKEKLLRNFNRCANWEEKYLYIIELGQRLAPLDDAERTPAHRIQGCQSQVWIVMNPGENGVIEMRGDSDAAIVKGLIAVVFALYQQMTAQDIVNFDVRPWFEEMSLTQHLTPSRSQGLEAMIRAIRAKAADLS",
        "proteome": "UP000000260",
        "gene": "sufE",
        "go_terms": [
            {
                "identifier": "GO:0006790",
                "name": "sulfur compound metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016226",
                "name": "iron-sulfur cluster assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "63ee8909197e2fa1f639e2794c848f778d79cfb7",
        "counters": {
            "domain_architectures": 14137,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14137
        }
    }
}