"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7MF58"	"{'domain_architectures': 14137, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 14137}"	"['Participates in cysteine desulfuration mediated by SufS. Cysteine desulfuration mobilizes sulfur from L-cysteine to yield L-alanine and constitutes an essential step in sulfur metabolism for biosynthesis of a variety of sulfur-containing biomolecules. Functions as a sulfur acceptor for SufS, by mediating the direct transfer of the sulfur atom from the S-sulfanylcysteine of SufS, an intermediate product of cysteine desulfuration process']"	"sufE"	"[{'identifier': 'GO:0006790', 'name': 'sulfur compound metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016226', 'name': 'iron-sulfur cluster assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"SUFE_CROS8"	"63ee8909197e2fa1f639e2794c848f778d79cfb7"	True	False	False	138	"Cysteine desulfuration protein SufE"	3	"UP000000260"	"MAGLPEKEKLLRNFNRCANWEEKYLYIIELGQRLAPLDDAERTPAHRIQGCQSQVWIVMNPGENGVIEMRGDSDAAIVKGLIAVVFALYQQMTAQDIVNFDVRPWFEEMSLTQHLTPSRSQGLEAMIRAIRAKAADLS"	"reviewed"	"{'taxId': '290339', 'scientificName': 'Cronobacter sakazakii (strain ATCC BAA-894)', 'fullName': 'Cronobacter sakazakii (strain ATCC BAA-894)'}"