GET /api/protein/UniProt/A7KX26/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A7KX26",
"id": "A7KX26_9GEMI",
"source_organism": {
"taxId": "452758",
"scientificName": "Begomovirus allamandae",
"fullName": "Begomovirus allamandae"
},
"name": "Transcriptional activator protein",
"description": [
"Strong activator of the late viral genes promoters. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity"
],
"length": 133,
"sequence": "MQHSSPSRSHSIPVKVQHRIAKHRPIRRRRLDLPCGCSIYKAINRADHGFTHRGEHHCGSSKEWRIYLDGAKSPLFQDHGTHQEDVLQEPRHHPCPSQIQPQPQEATGDSQVLPELEDLHSLTSSDLAFLKGF",
"proteome": "UP000202400",
"gene": "AC2",
"go_terms": [
{
"identifier": "GO:0005198",
"name": "structural molecule activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019028",
"name": "viral capsid",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "21ebf865137f01d276c484209b4972ea17d60f2f",
"counters": {
"domain_architectures": 4559,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"prints": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4559
}
}
}