"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7KX26"	"{'domain_architectures': 4559, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'prints': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4559}"	"['Strong activator of the late viral genes promoters. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity']"	"AC2"	"[{'identifier': 'GO:0005198', 'name': 'structural molecule activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019028', 'name': 'viral capsid', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A7KX26_9GEMI"	"21ebf865137f01d276c484209b4972ea17d60f2f"	False	False	False	133	"Transcriptional activator protein"	3	"UP000202400"	"MQHSSPSRSHSIPVKVQHRIAKHRPIRRRRLDLPCGCSIYKAINRADHGFTHRGEHHCGSSKEWRIYLDGAKSPLFQDHGTHQEDVLQEPRHHPCPSQIQPQPQEATGDSQVLPELEDLHSLTSSDLAFLKGF"	"unreviewed"	"{'taxId': '452758', 'scientificName': 'Begomovirus allamandae', 'fullName': 'Begomovirus allamandae'}"