GET /api/protein/UniProt/A7FNH1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A7FNH1",
"id": "NFI_YERP3",
"source_organism": {
"taxId": "349747",
"scientificName": "Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)",
"fullName": "Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)"
},
"name": "Endonuclease V",
"description": [
"DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the intact lesion on the nicked DNA"
],
"length": 234,
"sequence": "MFDTKALQAEQRQRASEISLHDGIDNQFVRFIAGADVGFEQHGEITRAAIAILRYPSLALVEYQVARVATSLPYIPGLLSFREYPALLAAWAQLQQRPDLILVDGQGIAHPRRLGVASHFGLLVDVPTIGVAKSRLCGDFLPLHQDVGAVQPLFDNDEQLGWVWRSKIRCNPLFISPGHRVSVGSALAWVQRCMAGYRLPEPTRWADAIASNRPQFQRWLRKNPDFLGKRRDMI",
"proteome": null,
"gene": "nfi",
"go_terms": [
{
"identifier": "GO:0004519",
"name": "endonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b5a39602cf38e8ce3ece3fd23a0477f612e3b1c6",
"counters": {
"domain_architectures": 9514,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 9514
}
}
}