"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7FNH1"	"{'domain_architectures': 9514, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 9514}"	"[""DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the intact lesion on the nicked DNA""]"	"nfi"	"[{'identifier': 'GO:0004519', 'name': 'endonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"NFI_YERP3"	"b5a39602cf38e8ce3ece3fd23a0477f612e3b1c6"	True	False	False	234	"Endonuclease V"	3	""	"MFDTKALQAEQRQRASEISLHDGIDNQFVRFIAGADVGFEQHGEITRAAIAILRYPSLALVEYQVARVATSLPYIPGLLSFREYPALLAAWAQLQQRPDLILVDGQGIAHPRRLGVASHFGLLVDVPTIGVAKSRLCGDFLPLHQDVGAVQPLFDNDEQLGWVWRSKIRCNPLFISPGHRVSVGSALAWVQRCMAGYRLPEPTRWADAIASNRPQFQRWLRKNPDFLGKRRDMI"	"reviewed"	"{'taxId': '349747', 'scientificName': 'Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)', 'fullName': 'Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)'}"