GET /api/protein/UniProt/A6ZS62/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A6ZS62",
"id": "A6ZS62_YEAS7",
"source_organism": {
"taxId": "307796",
"scientificName": "Saccharomyces cerevisiae (strain YJM789)",
"fullName": "Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)"
},
"name": "Proteinase inhibitor I2B (PBI2)",
"description": [
"Cytosolic inhibitor of vacuolar proteinase B (yscB), probably regulating protease B activity during limited proteolysis. PBI2 is a component of the LMA1 complex, which is involved in the facilitation of vesicle fusion such as homotypic vacuole and ER-derived COPII vesicle fusion with the Golgi"
],
"length": 75,
"sequence": "MTKNFIVTLKKNTPDVEAKKFLDSVHHAGGSIVHEFDIIKGYTIKVPDVLHLNKLKEKHNDVIENVEEDKEVHTN",
"proteome": null,
"gene": "PBI2",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1
}
}
}