"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A6ZS62"	"{'domain_architectures': 0, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1}"	"['Cytosolic inhibitor of vacuolar proteinase B (yscB), probably regulating protease B activity during limited proteolysis. PBI2 is a component of the LMA1 complex, which is involved in the facilitation of vesicle fusion such as homotypic vacuole and ER-derived COPII vesicle fusion with the Golgi']"	"PBI2"	""	"A6ZS62_YEAS7"	""	True	False	False	75	"Proteinase inhibitor I2B (PBI2)"	3	""	"MTKNFIVTLKKNTPDVEAKKFLDSVHHAGGSIVHEFDIIKGYTIKVPDVLHLNKLKEKHNDVIENVEEDKEVHTN"	"unreviewed"	"{'taxId': '307796', 'scientificName': 'Saccharomyces cerevisiae (strain YJM789)', 'fullName': ""Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)""}"