GET /api/protein/UniProt/A6YAI3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6YAI3",
        "id": "A6YAI3_MICIN",
        "source_organism": {
            "taxId": "3799",
            "scientificName": "Micranthes integrifolia",
            "fullName": "Micranthes integrifolia (Wholeleaf saxifrage)"
        },
        "name": "Photosystem II reaction center protein T",
        "description": [
            "Found at the monomer-monomer interface of the photosystem II (PS II) dimer, plays a role in assembly and dimerization of PSII. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating a proton gradient subsequently used for ATP formation"
        ],
        "length": 35,
        "sequence": "MEALVYTFLLVSTLGIIFFAIFFREPPTVPTKKSK",
        "proteome": null,
        "gene": "psbT",
        "go_terms": [
            {
                "identifier": "GO:0015979",
                "name": "photosynthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009523",
                "name": "photosystem II",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0009539",
                "name": "photosystem II reaction center",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "159706e7ef5b54f14c3f94440dbaf86f3b9e758d",
        "counters": {
            "domain_architectures": 15714,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 15714
        }
    }
}