"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A6YAI3"	"{'domain_architectures': 15714, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 15714}"	"['Found at the monomer-monomer interface of the photosystem II (PS II) dimer, plays a role in assembly and dimerization of PSII. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating a proton gradient subsequently used for ATP formation']"	"psbT"	"[{'identifier': 'GO:0015979', 'name': 'photosynthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009523', 'name': 'photosystem II', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0009539', 'name': 'photosystem II reaction center', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A6YAI3_MICIN"	"159706e7ef5b54f14c3f94440dbaf86f3b9e758d"	True	False	False	35	"Photosystem II reaction center protein T"	3	""	"MEALVYTFLLVSTLGIIFFAIFFREPPTVPTKKSK"	"unreviewed"	"{'taxId': '3799', 'scientificName': 'Micranthes integrifolia', 'fullName': 'Micranthes integrifolia (Wholeleaf saxifrage)'}"