General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6VFN4",
        "id": "RIBL_METM7",
        "source_organism": {
            "taxId": "426368",
            "scientificName": "Methanococcus maripaludis (strain C7 / ATCC BAA-1331)",
            "fullName": "Methanococcus maripaludis (strain C7 / ATCC BAA-1331)"
        },
        "name": "FAD synthase",
        "description": [
            "Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme"
        ],
        "length": 150,
        "sequence": "MEKKIAVTAGTFDLLHPGHFNTLNFAKKHADELVVIIARDETVKKIKGRSPVIPEEQRKIMIEALKPVDRAVLGSLTNKLEPILEIRPDIIVLGPDQTTYQITELKSQLAKHFLYPEVLKVEEYVRCPFHSSFDILKEIVRRWCCKELKV",
        "proteome": null,
        "gene": "ribL",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003919",
                "name": "FMN adenylyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006747",
                "name": "FAD biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046444",
                "name": "FMN metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "67074276eca3dd0a1392f72a13e344b6dc27e68b",
        "counters": {
            "domain_architectures": 82434,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 82434
        }
    }
}