"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A6VFN4"	"{'domain_architectures': 82434, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'ncbifam': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 82434}"	"['Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme']"	"ribL"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009058', 'name': 'biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003919', 'name': 'FMN adenylyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006747', 'name': 'FAD biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0046444', 'name': 'FMN metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RIBL_METM7"	"67074276eca3dd0a1392f72a13e344b6dc27e68b"	True	False	False	150	"FAD synthase"	3	""	"MEKKIAVTAGTFDLLHPGHFNTLNFAKKHADELVVIIARDETVKKIKGRSPVIPEEQRKIMIEALKPVDRAVLGSLTNKLEPILEIRPDIIVLGPDQTTYQITELKSQLAKHFLYPEVLKVEEYVRCPFHSSFDILKEIVRRWCCKELKV"	"reviewed"	"{'taxId': '426368', 'scientificName': 'Methanococcus maripaludis (strain C7 / ATCC BAA-1331)', 'fullName': 'Methanococcus maripaludis (strain C7 / ATCC BAA-1331)'}"