GET /api/protein/UniProt/A6V4H3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A6V4H3",
"id": "LOLA_PSEP7",
"source_organism": {
"taxId": "381754",
"scientificName": "Pseudomonas paraeruginosa (strain DSM 24068 / PA7)",
"fullName": "Pseudomonas paraeruginosa (strain DSM 24068 / PA7)"
},
"name": "Outer-membrane lipoprotein carrier protein",
"description": [
"Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane)"
],
"length": 208,
"sequence": "MRLIRTLFVAALAMGTSLAHADDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTPALLLSGDISKISESFAITYKEGGNVVDFVLKPKTKDTLFDTLRLSFRSGKVNDMQMIDGVGQRTNILFFDVKMNEALDAKQFTFDVPPGVDVIQE",
"proteome": null,
"gene": "lolA",
"go_terms": [
{
"identifier": "GO:0042953",
"name": "lipoprotein transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042597",
"name": "periplasmic space",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5630deebc2599e21dae9bc48e0d9d50fdf3dbbc8",
"counters": {
"domain_architectures": 14788,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 14788
}
}
}