"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A6V4H3"	"{'domain_architectures': 14788, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 14788}"	"['Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane)']"	"lolA"	"[{'identifier': 'GO:0042953', 'name': 'lipoprotein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0042597', 'name': 'periplasmic space', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"LOLA_PSEP7"	"5630deebc2599e21dae9bc48e0d9d50fdf3dbbc8"	True	False	False	208	"Outer-membrane lipoprotein carrier protein"	3	""	"MRLIRTLFVAALAMGTSLAHADDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTPALLLSGDISKISESFAITYKEGGNVVDFVLKPKTKDTLFDTLRLSFRSGKVNDMQMIDGVGQRTNILFFDVKMNEALDAKQFTFDVPPGVDVIQE"	"reviewed"	"{'taxId': '381754', 'scientificName': 'Pseudomonas paraeruginosa (strain DSM 24068 / PA7)', 'fullName': 'Pseudomonas paraeruginosa (strain DSM 24068 / PA7)'}"