HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A6MN33",
"id": "A6MN33_EPTFU",
"source_organism": {
"taxId": "29078",
"scientificName": "Eptesicus fuscus",
"fullName": "Eptesicus fuscus (Big brown bat)"
},
"name": "Beta-2 adrenergic receptor",
"description": [
"Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine"
],
"length": 214,
"sequence": "FGASHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARMVILMVWIVSGLTSFLPIQMHWYRATHDEAIKCYAKDTCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQRIDKFAGRFHAQNLSQVEDGRXGHGHRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLI",
"proteome": null,
"gene": "ADRB2",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004930",
"name": "G protein-coupled receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007186",
"name": "G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004941",
"name": "beta2-adrenergic receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006940",
"name": "regulation of smooth muscle contraction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007189",
"name": "adenylate cyclase-activating G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0097746",
"name": "blood vessel diameter maintenance",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
"counters": {
"domain_architectures": 394800,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 2,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 394800
}
}
}