GET /api/protein/UniProt/A6H7B8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A6H7B8",
"id": "PGAP2_BOVIN",
"source_organism": {
"taxId": "9913",
"scientificName": "Bos taurus",
"fullName": "Bos taurus (Bovine)"
},
"name": "Acyltransferase PGAP2",
"description": [
"Involved in the fatty acid remodeling steps of GPI-anchor maturation where the unsaturated acyl chain at sn-2 of inositol phosphate is replaced by a saturated stearoyl chain. May catalyze the second step of the fatty acid remodeling, by reacylating a lyso-GPI intermediate at sn-2 of inositol phosphate by a saturated chain. The fatty acid remodeling steps is critical for the integration of GPI-APs into lipid rafts"
],
"length": 254,
"sequence": "MYQVPLPLDRDGTLVRLRFTLVALVTVCCPLVAFLFCVLWSLLFHFKETTATHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCAGYRPLCRLNFGLNVVENVALLVLTYVSSSEDFTIHENAFIVFIASSLSHMLLTCILWRLTKKHTVSQEDRKSYNWKQRLFIINFVSFFTALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPEEKRF",
"proteome": "UP000009136",
"gene": "PGAP2",
"go_terms": [
{
"identifier": "GO:0000139",
"name": "Golgi membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ab18c14a05b6d083e3b0fef65d3721398aa0f31f",
"counters": {
"domain_architectures": 12942,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12942
}
}
}