General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6H7B8",
        "id": "PGAP2_BOVIN",
        "source_organism": {
            "taxId": "9913",
            "scientificName": "Bos taurus",
            "fullName": "Bos taurus (Bovine)"
        },
        "name": "Acyltransferase PGAP2",
        "description": [
            "Involved in the fatty acid remodeling steps of GPI-anchor maturation where the unsaturated acyl chain at sn-2 of inositol phosphate is replaced by a saturated stearoyl chain. May catalyze the second step of the fatty acid remodeling, by reacylating a lyso-GPI intermediate at sn-2 of inositol phosphate by a saturated chain. The fatty acid remodeling steps is critical for the integration of GPI-APs into lipid rafts"
        ],
        "length": 254,
        "sequence": "MYQVPLPLDRDGTLVRLRFTLVALVTVCCPLVAFLFCVLWSLLFHFKETTATHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCAGYRPLCRLNFGLNVVENVALLVLTYVSSSEDFTIHENAFIVFIASSLSHMLLTCILWRLTKKHTVSQEDRKSYNWKQRLFIINFVSFFTALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPEEKRF",
        "proteome": "UP000009136",
        "gene": "PGAP2",
        "go_terms": [
            {
                "identifier": "GO:0000139",
                "name": "Golgi membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ab18c14a05b6d083e3b0fef65d3721398aa0f31f",
        "counters": {
            "domain_architectures": 12942,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12942
        }
    }
}