"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A6H7B8"	"{'domain_architectures': 12942, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 12942}"	"['Involved in the fatty acid remodeling steps of GPI-anchor maturation where the unsaturated acyl chain at sn-2 of inositol phosphate is replaced by a saturated stearoyl chain. May catalyze the second step of the fatty acid remodeling, by reacylating a lyso-GPI intermediate at sn-2 of inositol phosphate by a saturated chain. The fatty acid remodeling steps is critical for the integration of GPI-APs into lipid rafts']"	"PGAP2"	"[{'identifier': 'GO:0000139', 'name': 'Golgi membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"PGAP2_BOVIN"	"ab18c14a05b6d083e3b0fef65d3721398aa0f31f"	True	False	False	254	"Acyltransferase PGAP2"	2	"UP000009136"	"MYQVPLPLDRDGTLVRLRFTLVALVTVCCPLVAFLFCVLWSLLFHFKETTATHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCAGYRPLCRLNFGLNVVENVALLVLTYVSSSEDFTIHENAFIVFIASSLSHMLLTCILWRLTKKHTVSQEDRKSYNWKQRLFIINFVSFFTALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPEEKRF"	"reviewed"	"{'taxId': '9913', 'scientificName': 'Bos taurus', 'fullName': 'Bos taurus (Bovine)'}"