HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5VYP1",
"id": "CYOE2_PSEP1",
"source_organism": {
"taxId": "351746",
"scientificName": "Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)",
"fullName": "Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)"
},
"name": "Protoheme IX farnesyltransferase 2",
"description": [
"Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group"
],
"length": 295,
"sequence": "MSVKHFIQITKPGIIFGNVLSVAGGFFLASKGHVDFALFLAVVIGTSLVVASGCVFNNCIDRDIDHKMERTKNRVMVQGGMSLPLALIYATLLGVAGFSLLYVQANPLSAFCALIGFVVYVGFYSLWLKRKSVHGTLVGSLSGAMPPVIGYCAVSNSFDLAAVTLLVMFSLWQMPHSFAIAIFRFKDYSAANIPVLPVARGILAAKKQIVLYVLAFVLATLMLTLGGYAGLGYLAVAAAMGLYWLYMAWGGYKAEDDSKWARKVFGFSILTVTALSVMMGVDSQTAADVLMTYAR",
"proteome": null,
"gene": "cyoE2",
"go_terms": [
{
"identifier": "GO:0008495",
"name": "protoheme IX farnesyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006783",
"name": "heme biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016765",
"name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1ef8fd2ce97f2751111ca5e0efe0086d9a133586",
"counters": {
"domain_architectures": 88233,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 88233
}
}
}