"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A5VYP1"	"{'domain_architectures': 88233, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'pfam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 88233}"	"['Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group']"	"cyoE2"	"[{'identifier': 'GO:0008495', 'name': 'protoheme IX farnesyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006783', 'name': 'heme biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016765', 'name': 'transferase activity, transferring alkyl or aryl (other than methyl) groups', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"CYOE2_PSEP1"	"1ef8fd2ce97f2751111ca5e0efe0086d9a133586"	True	False	False	295	"Protoheme IX farnesyltransferase 2"	3	""	"MSVKHFIQITKPGIIFGNVLSVAGGFFLASKGHVDFALFLAVVIGTSLVVASGCVFNNCIDRDIDHKMERTKNRVMVQGGMSLPLALIYATLLGVAGFSLLYVQANPLSAFCALIGFVVYVGFYSLWLKRKSVHGTLVGSLSGAMPPVIGYCAVSNSFDLAAVTLLVMFSLWQMPHSFAIAIFRFKDYSAANIPVLPVARGILAAKKQIVLYVLAFVLATLMLTLGGYAGLGYLAVAAAMGLYWLYMAWGGYKAEDDSKWARKVFGFSILTVTALSVMMGVDSQTAADVLMTYAR"	"reviewed"	"{'taxId': '351746', 'scientificName': 'Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)', 'fullName': 'Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)'}"