GET /api/protein/UniProt/A5N597/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A5N597",
        "id": "QUEC_CLOK5",
        "source_organism": {
            "taxId": "431943",
            "scientificName": "Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NBRC 12016 / NCIMB 10680 / K1)",
            "fullName": "Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NBRC 12016 / NCIMB 10680 / K1)"
        },
        "name": "7-cyano-7-deazaguanine synthase",
        "description": [
            "Catalyzes the ATP-dependent conversion of 7-carboxy-7-deazaguanine (CDG) to 7-cyano-7-deazaguanine (preQ(0))"
        ],
        "length": 226,
        "sequence": "MKKAVVLLSGGLDSTTVLYLAKSQGYEVYAMSFDYGQRHKKEIQCARDVASGTGAADFVLVTTNMNAWGGSALTDNSIKVPEFNEESEKIPVTYVPARNMIFLSYAASYAETIGAYDIFIGVSEVDYSGYVDCRHEFIDSMEKTINLGTVCAVEHKKYIKIHAPFLYKTKSEEIKIGMDLGVKYEKTWTCYNGEEFACGICDSCRLRLEAFKEAGYKDPIKYKGEK",
        "proteome": "UP000002411",
        "gene": "queC",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "51ce1a637c0a5d799728e3458f59f91d81e66d4f",
        "counters": {
            "domain_architectures": 16737,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 16737
        }
    }
}