GET /api/protein/UniProt/A5N597/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5N597",
"id": "QUEC_CLOK5",
"source_organism": {
"taxId": "431943",
"scientificName": "Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NBRC 12016 / NCIMB 10680 / K1)",
"fullName": "Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NBRC 12016 / NCIMB 10680 / K1)"
},
"name": "7-cyano-7-deazaguanine synthase",
"description": [
"Catalyzes the ATP-dependent conversion of 7-carboxy-7-deazaguanine (CDG) to 7-cyano-7-deazaguanine (preQ(0))"
],
"length": 226,
"sequence": "MKKAVVLLSGGLDSTTVLYLAKSQGYEVYAMSFDYGQRHKKEIQCARDVASGTGAADFVLVTTNMNAWGGSALTDNSIKVPEFNEESEKIPVTYVPARNMIFLSYAASYAETIGAYDIFIGVSEVDYSGYVDCRHEFIDSMEKTINLGTVCAVEHKKYIKIHAPFLYKTKSEEIKIGMDLGVKYEKTWTCYNGEEFACGICDSCRLRLEAFKEAGYKDPIKYKGEK",
"proteome": "UP000002411",
"gene": "queC",
"go_terms": null,
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "51ce1a637c0a5d799728e3458f59f91d81e66d4f",
"counters": {
"domain_architectures": 16737,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 16737
}
}
}