"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A5N597"	"{'domain_architectures': 11039, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'pirsf': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 11039}"	"['Catalyzes the ATP-dependent conversion of 7-carboxy-7-deazaguanine (CDG) to 7-cyano-7-deazaguanine (preQ(0))']"	"queC"	""	"QUEC_CLOK5"	"51ce1a637c0a5d799728e3458f59f91d81e66d4f"	True	False	226	"7-cyano-7-deazaguanine synthase"	3	"UP000002411"	"MKKAVVLLSGGLDSTTVLYLAKSQGYEVYAMSFDYGQRHKKEIQCARDVASGTGAADFVLVTTNMNAWGGSALTDNSIKVPEFNEESEKIPVTYVPARNMIFLSYAASYAETIGAYDIFIGVSEVDYSGYVDCRHEFIDSMEKTINLGTVCAVEHKKYIKIHAPFLYKTKSEEIKIGMDLGVKYEKTWTCYNGEEFACGICDSCRLRLEAFKEAGYKDPIKYKGEK"	"reviewed"	"{'taxId': '431943', 'scientificName': 'Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NBRC 12016 / NCIMB 10680 / K1)', 'fullName': 'Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NBRC 12016 / NCIMB 10680 / K1)'}"