General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A4N1P7",
        "id": "A4N1P7_HAEIF",
        "source_organism": {
            "taxId": "375432",
            "scientificName": "Haemophilus influenzae R3021",
            "fullName": "Haemophilus influenzae R3021"
        },
        "name": "Nucleoid occlusion factor SlmA",
        "description": [
            "Required for nucleoid occlusion (NO) phenomenon, which prevents Z-ring formation and cell division over the nucleoid. Acts as a DNA-associated cell division inhibitor that binds simultaneously chromosomal DNA and FtsZ, and disrupts the assembly of FtsZ polymers. SlmA-DNA-binding sequences (SBS) are dispersed on non-Ter regions of the chromosome, preventing FtsZ polymerization at these regions"
        ],
        "length": 218,
        "sequence": "MVEEQLSLSGVEEIAPKIETPKIEKRTVKERRQQVLTVLIHMLHSERGMERMTTARLAKEVGVSEAALYRYFPSKTKMFEALIEHIESTLLSRITASMRNETQTMNRIHDILQTILDFARKNPGLTRVLTGHALMFEEAQLQARVAQFFDRLEMQFVNILQMRKLREGRAFNVDERIIASHLVTLCEGQFMRYVRTNFRLNSSQSFEQQWRFIEPLFA",
        "proteome": null,
        "gene": "slmA",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010974",
                "name": "negative regulation of division septum assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c96105245d3ca3316beb0975275d2e65c6aed482",
        "counters": {
            "domain_architectures": 3638,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 2,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3638
        }
    }
}