"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4N1P7"	"{'domain_architectures': 3638, 'entries': 17, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 1, 'profile': 1, 'pfam': 2, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3638}"	"['Required for nucleoid occlusion (NO) phenomenon, which prevents Z-ring formation and cell division over the nucleoid. Acts as a DNA-associated cell division inhibitor that binds simultaneously chromosomal DNA and FtsZ, and disrupts the assembly of FtsZ polymers. SlmA-DNA-binding sequences (SBS) are dispersed on non-Ter regions of the chromosome, preventing FtsZ polymerization at these regions']"	"slmA"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0010974', 'name': 'negative regulation of division septum assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A4N1P7_HAEIF"	"c96105245d3ca3316beb0975275d2e65c6aed482"	True	False	False	218	"Nucleoid occlusion factor SlmA"	3	""	"MVEEQLSLSGVEEIAPKIETPKIEKRTVKERRQQVLTVLIHMLHSERGMERMTTARLAKEVGVSEAALYRYFPSKTKMFEALIEHIESTLLSRITASMRNETQTMNRIHDILQTILDFARKNPGLTRVLTGHALMFEEAQLQARVAQFFDRLEMQFVNILQMRKLREGRAFNVDERIIASHLVTLCEGQFMRYVRTNFRLNSSQSFEQQWRFIEPLFA"	"unreviewed"	"{'taxId': '375432', 'scientificName': 'Haemophilus influenzae R3021', 'fullName': 'Haemophilus influenzae R3021'}"
