General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A4KA36",
        "id": "PROF8_PHLPR",
        "source_organism": {
            "taxId": "15957",
            "scientificName": "Phleum pratense",
            "fullName": "Phleum pratense (Common timothy)"
        },
        "name": "Profilin-8",
        "description": [
            "Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations (By similarity)"
        ],
        "length": 131,
        "sequence": "MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLKQGL",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003779",
                "name": "actin binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9a5573d0ebb5c532b4444f54b2266218d455b937",
        "counters": {
            "domain_architectures": 10196,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 10196
        }
    }
}