"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4KA36"	"{'domain_architectures': 10196, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'smart': 1, 'cdd': 1, 'ssf': 1, 'panther': 1, 'prints': 2, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 10196}"	"['Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations (By similarity)']"	""	"[{'identifier': 'GO:0003779', 'name': 'actin binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"PROF8_PHLPR"	"9a5573d0ebb5c532b4444f54b2266218d455b937"	True	False	False	131	"Profilin-8"	1	""	"MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLKQGL"	"reviewed"	"{'taxId': '15957', 'scientificName': 'Phleum pratense', 'fullName': 'Phleum pratense (Common timothy)'}"