General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A4IFE2",
        "id": "A4IFE2_BOVIN",
        "source_organism": {
            "taxId": "9913",
            "scientificName": "Bos taurus",
            "fullName": "Bos taurus (Bovine)"
        },
        "name": "RING finger and CHY zinc finger domain-containing protein 1",
        "description": [
            "E3 ubiquitin-protein ligase that mediates ubiquitination of target proteins, including p53/TP53, TP73, HDAC1 and CDKN1B. Mediates ubiquitination and degradation of p53/TP53; preferentially acts on tetrameric p53/TP53. Catalyzes monoubiquitinates the translesion DNA polymerase POLH. Involved in the ribosome-associated quality control (RQC) pathway, which mediates the extraction of incompletely synthesized nascent chains from stalled ribosomes: RCHY1 acts downstream of NEMF and recognizes CAT tails associated with stalled nascent chains, leading to their ubiquitination and degradation"
        ],
        "length": 261,
        "sequence": "MAFSALEDGARGQAQRRRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYYCSVCHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGKHKCIENVSRQNCPICLEDIHTSRIAAQVLPCGHLLHRTCYEDMLKEGYRCPLCMRSALDMSRSWRQRDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCNICESYNTAQAGKYRISIDQQ",
        "proteome": "UP000009136",
        "gene": "RCHY1",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "de01633899f43b66341fedeb4895668a4a4f9bec",
        "counters": {
            "domain_architectures": 4230,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 3,
                "ssf": 3,
                "pfam": 3,
                "cathgene3d": 2,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4230
        }
    }
}