"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4IFE2"	"{'domain_architectures': 4230, 'entries': 21, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 3, 'ssf': 3, 'pfam': 3, 'cathgene3d': 2, 'cdd': 1, 'smart': 1, 'panther': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4230}"	"['E3 ubiquitin-protein ligase that mediates ubiquitination of target proteins, including p53/TP53, TP73, HDAC1 and CDKN1B. Mediates ubiquitination and degradation of p53/TP53; preferentially acts on tetrameric p53/TP53. Catalyzes monoubiquitinates the translesion DNA polymerase POLH. Involved in the ribosome-associated quality control (RQC) pathway, which mediates the extraction of incompletely synthesized nascent chains from stalled ribosomes: RCHY1 acts downstream of NEMF and recognizes CAT tails associated with stalled nascent chains, leading to their ubiquitination and degradation']"	"RCHY1"	"[{'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A4IFE2_BOVIN"	"de01633899f43b66341fedeb4895668a4a4f9bec"	True	False	False	261	"RING finger and CHY zinc finger domain-containing protein 1"	2	"UP000009136"	"MAFSALEDGARGQAQRRRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYYCSVCHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGKHKCIENVSRQNCPICLEDIHTSRIAAQVLPCGHLLHRTCYEDMLKEGYRCPLCMRSALDMSRSWRQRDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCNICESYNTAQAGKYRISIDQQ"	"unreviewed"	"{'taxId': '9913', 'scientificName': 'Bos taurus', 'fullName': 'Bos taurus (Bovine)'}"