General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A4I1W6",
        "id": "A4I1W6_LEIIN",
        "source_organism": {
            "taxId": "5671",
            "scientificName": "Leishmania infantum",
            "fullName": "Leishmania infantum"
        },
        "name": "Cleavage and polyadenylation specificity factor subunit 5",
        "description": [
            "Component of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3'-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs. CFIm contributes to the recruitment of multiprotein complexes on specific sequences on the pre-mRNA 3'-end, so called cleavage and polyadenylation signals (pA signals). Most pre-mRNAs contain multiple pA signals, resulting in alternative cleavage and polyadenylation (APA) producing mRNAs with variable 3'-end formation. The CFIm complex acts as a key regulator of cleavage and polyadenylation site choice during APA through its binding to 5'-UGUA-3' elements localized in the 3'-untranslated region (UTR) for a huge number of pre-mRNAs"
        ],
        "length": 271,
        "sequence": "MSLKAKLDVYPLENYTQTSVDVSNGHAGVAGNKVNLGAGNSAPFRPPSAIEKLLSLKKRCEEEPCVHSVEGVLLVHLHRHPHILLMKQINLRTHDADGMRTVPPSNTNAEATYRLPGGRCRRGEAEESCLLRKLGRHLLNEAKAPAGAAEVASAGNSDTVVDVGMTHNASKAGSCFRVGEVLATWYRPHFTPHMYPYVPAHIAAGSVREVRAIYLVHLEPTVYFSMVQEGVELVAAPLFDLYENASKYGPIIASLPALLSRVLINYCSTEY",
        "proteome": "UP000008153",
        "gene": "LINJ_26_0280",
        "go_terms": [
            {
                "identifier": "GO:0003729",
                "name": "mRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0031124",
                "name": "mRNA 3'-end processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005849",
                "name": "mRNA cleavage factor complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1abbcd35c1fbc9bb803fc45a3dfc3272dc7bafbb",
        "counters": {
            "domain_architectures": 4834,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4834
        }
    }
}