General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A4FW17",
        "id": "A4FW17_METM5",
        "source_organism": {
            "taxId": "402880",
            "scientificName": "Methanococcus maripaludis (strain C5 / ATCC BAA-1333)",
            "fullName": "Methanococcus maripaludis (strain C5 / ATCC BAA-1333)"
        },
        "name": "Pyruvate synthase subunit PorD",
        "description": null,
        "length": 85,
        "sequence": "MVNTGTIIYEPGSSANNKTGSWRVFKPVLDQEKCVKCENCYIFCPEGCIQEKDGKFEIDYDYCKGCLICEKECPVKAIKTEREEK",
        "proteome": null,
        "gene": "MmarC5_0071",
        "go_terms": [
            {
                "identifier": "GO:0016625",
                "name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "50f692799a4aac31f6710e3d85c099934fdbb2f6",
        "counters": {
            "domain_architectures": 13962,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 13962
        }
    }
}