"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4FW17"	"{'domain_architectures': 13962, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'profile': 1, 'cathgene3d': 1, 'pfam': 1, 'ncbifam': 2, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 13962}"	""	"MmarC5_0071"	"[{'identifier': 'GO:0016625', 'name': 'oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A4FW17_METM5"	"50f692799a4aac31f6710e3d85c099934fdbb2f6"	True	False	False	85	"Pyruvate synthase subunit PorD"	4	""	"MVNTGTIIYEPGSSANNKTGSWRVFKPVLDQEKCVKCENCYIFCPEGCIQEKDGKFEIDYDYCKGCLICEKECPVKAIKTEREEK"	"unreviewed"	"{'taxId': '402880', 'scientificName': 'Methanococcus maripaludis (strain C5 / ATCC BAA-1333)', 'fullName': 'Methanococcus maripaludis (strain C5 / ATCC BAA-1333)'}"