General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A3MX10",
        "id": "NTPTH_PYRCJ",
        "source_organism": {
            "taxId": "410359",
            "scientificName": "Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)",
            "fullName": "Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)"
        },
        "name": "Nucleoside-triphosphatase THEP1",
        "description": [
            "Has nucleotide phosphatase activity towards ATP, GTP, CTP, TTP and UTP. May hydrolyze nucleoside diphosphates with lower efficiency"
        ],
        "length": 175,
        "sequence": "MTWRERAEKLLIGISGMPGVGKTTLVLRVLELARSKYRCCGFVTVEVRERGVRIGFDTIDVVSGARVPLARVGTGSPSVGKYVVNLPSCEVISRALRQEDCEVAFIDEIGAMEFKCPTFYTDLRVAVDRIPRIIATVHRNYIHTAEKLGFEIIWLTRENWNSTLSTVLKALSLST",
        "proteome": "UP000001431",
        "gene": "Pcal_1760",
        "go_terms": [
            {
                "identifier": "GO:0017111",
                "name": "ribonucleoside triphosphate phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e74758da59a1034b6788fbc3b90a4e045b7a58d1",
        "counters": {
            "domain_architectures": 3379,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3379
        }
    }
}