"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A3MX10"	"{'domain_architectures': 3379, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3379}"	"['Has nucleotide phosphatase activity towards ATP, GTP, CTP, TTP and UTP. May hydrolyze nucleoside diphosphates with lower efficiency']"	"Pcal_1760"	"[{'identifier': 'GO:0017111', 'name': 'ribonucleoside triphosphate phosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"NTPTH_PYRCJ"	"e74758da59a1034b6788fbc3b90a4e045b7a58d1"	True	False	False	175	"Nucleoside-triphosphatase THEP1"	3	"UP000001431"	"MTWRERAEKLLIGISGMPGVGKTTLVLRVLELARSKYRCCGFVTVEVRERGVRIGFDTIDVVSGARVPLARVGTGSPSVGKYVVNLPSCEVISRALRQEDCEVAFIDEIGAMEFKCPTFYTDLRVAVDRIPRIIATVHRNYIHTAEKLGFEIIWLTRENWNSTLSTVLKALSLST"	"reviewed"	"{'taxId': '410359', 'scientificName': 'Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)', 'fullName': 'Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)'}"