GET /api/protein/UniProt/A2ZAT1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A2ZAT1",
"id": "A2ZAT1_ORYSI",
"source_organism": {
"taxId": "39946",
"scientificName": "Oryza sativa subsp. indica",
"fullName": "Oryza sativa subsp. indica (Rice)"
},
"name": "Non-specific lipid-transfer protein",
"description": [
"Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues"
],
"length": 116,
"sequence": "MARAQLVLVAVVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS",
"proteome": "UP000007015",
"gene": "OsI_34866",
"go_terms": [
{
"identifier": "GO:0008289",
"name": "lipid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006869",
"name": "lipid transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6a7adb097b91ab299c5131e16e3c2dca19fb6e23",
"counters": {
"domain_architectures": 15301,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15301
}
}
}