"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A2ZAT1"	"{'domain_architectures': 15301, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'ssf': 1, 'cathgene3d': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 15301}"	"['Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues']"	"OsI_34866"	"[{'identifier': 'GO:0008289', 'name': 'lipid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006869', 'name': 'lipid transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A2ZAT1_ORYSI"	"6a7adb097b91ab299c5131e16e3c2dca19fb6e23"	True	False	False	116	"Non-specific lipid-transfer protein"	3	"UP000007015"	"MARAQLVLVAVVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS"	"unreviewed"	"{'taxId': '39946', 'scientificName': 'Oryza sativa subsp. indica', 'fullName': 'Oryza sativa subsp. indica (Rice)'}"