GET /api/protein/UniProt/A2SU09/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A2SU09",
        "id": "A2SU09_METLZ",
        "source_organism": {
            "taxId": "410358",
            "scientificName": "Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)",
            "fullName": "Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)"
        },
        "name": "2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase",
        "description": [
            "Catalyzes a transaldol reaction between 6-deoxy-5-ketofructose 1-phosphate (DKFP) and L-aspartate semialdehyde (ASA) with an elimination of hydroxypyruvaldehyde phosphate to yield 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate (ADH). Plays a key role in an alternative pathway of the biosynthesis of 3-dehydroquinate (DHQ), which is involved in the canonical pathway for the biosynthesis of aromatic amino acids"
        ],
        "length": 264,
        "sequence": "MFGKHIRMERIIDRNSGRAVIVPLDHGISMGPIPGLTDMRDTRNKISIGGATAVLMHKGMVPYGHRTSGKDIGLIVHLSAGTGLGTDPNSKVIVTTVEEAITLGADAVSIHINLGADTEPEMICNAGEISRKCQQWGMPLLAMVYPRGKNIKDSFDVDALKTCARVAAELGADLVKTSYTGDIDTFREVVRGAQIPVVIAGGPKMGSDLEMLQMVRDSLDAGGKGVSIGRNIFQHNDIIGITSAVSDIVLRDASVEEAAKHLTR",
        "proteome": "UP000000365",
        "gene": "aroA'",
        "go_terms": [
            {
                "identifier": "GO:0016829",
                "name": "lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004332",
                "name": "fructose-bisphosphate aldolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016836",
                "name": "hydro-lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009073",
                "name": "aromatic amino acid family biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eef5f42e892995aae7b9ad95dbe411ff3160f897",
        "counters": {
            "domain_architectures": 38504,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 38504
        }
    }
}