"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A2SU09"	"{'domain_architectures': 38504, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 2, 'pirsf': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 38504}"	"['Catalyzes a transaldol reaction between 6-deoxy-5-ketofructose 1-phosphate (DKFP) and L-aspartate semialdehyde (ASA) with an elimination of hydroxypyruvaldehyde phosphate to yield 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate (ADH). Plays a key role in an alternative pathway of the biosynthesis of 3-dehydroquinate (DHQ), which is involved in the canonical pathway for the biosynthesis of aromatic amino acids']"	"aroA'"	"[{'identifier': 'GO:0016829', 'name': 'lyase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004332', 'name': 'fructose-bisphosphate aldolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016836', 'name': 'hydro-lyase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009073', 'name': 'aromatic amino acid family biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A2SU09_METLZ"	"eef5f42e892995aae7b9ad95dbe411ff3160f897"	True	False	False	264	"2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase"	3	"UP000000365"	"MFGKHIRMERIIDRNSGRAVIVPLDHGISMGPIPGLTDMRDTRNKISIGGATAVLMHKGMVPYGHRTSGKDIGLIVHLSAGTGLGTDPNSKVIVTTVEEAITLGADAVSIHINLGADTEPEMICNAGEISRKCQQWGMPLLAMVYPRGKNIKDSFDVDALKTCARVAAELGADLVKTSYTGDIDTFREVVRGAQIPVVIAGGPKMGSDLEMLQMVRDSLDAGGKGVSIGRNIFQHNDIIGITSAVSDIVLRDASVEEAAKHLTR"	"unreviewed"	"{'taxId': '410358', 'scientificName': 'Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)', 'fullName': 'Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)'}"
