General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A2S613",
        "id": "A2S613_BURM9",
        "source_organism": {
            "taxId": "412022",
            "scientificName": "Burkholderia mallei (strain NCTC 10229)",
            "fullName": "Burkholderia mallei (strain NCTC 10229)"
        },
        "name": "Ubiquinone biosynthesis accessory factor UbiK",
        "description": [
            "Required for efficient ubiquinone (coenzyme Q) biosynthesis. UbiK is probably an accessory factor of Ubi enzymes and facilitates ubiquinone biosynthesis by acting as an assembly factor, a targeting factor, or both"
        ],
        "length": 83,
        "sequence": "MKQPSDVFNDLQARIGDLLKNSPAKDVERNVKAMLTQGFSKLDLVTREEFDTQAQVLARTRARLEELEKRVAELEQKLADVQS",
        "proteome": null,
        "gene": "ubiK",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2969ed37e6f61e3543aa1c386f98f7a18ae596c7",
        "counters": {
            "domain_architectures": 8425,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8425
        }
    }
}